DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox4a

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_998287.1 Gene:sox4a / 336346 ZFINID:ZDB-GENE-030131-8290 Length:363 Species:Danio rerio


Alignment Length:281 Identity:88/281 - (31%)
Similarity:123/281 - (43%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 TNSERSAALDPESLNSGQL------GPVPASPSSQPLRQGNGHGHGGNHGHV----HSKPHIKRP 426
            ::|..|..|..:|::||::      .|.|.||:|           .|:...:    ....|||||
Zfish    14 SSSSSSDVLPGDSIDSGEMDLDMDASPTPGSPNS-----------AGDKMDIAWCKTPSGHIKRP 67

  Fly   427 MNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYR 491
            |||||||::.|||||::..|||||:.|||.||.|||.:.::||.|:..|..||...||..:|||:
Zfish    68 MNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYK 132

  Fly   492 YRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACPKGSGGSNSQV 556
            ||||         ||::.|..|.   ..:||.         ||...|   |.:..|.|..:.|:.
Zfish   133 YRPR---------KKVKSSSGKT---GEKAER---------VSASPG---AKSASKKSSKTLSRT 173

  Fly   557 -------------------AVAAAAAVYHLQDMASSAASTAH---GHDCGHTPPQQFFYPPESLS 599
                               |:..:.:|...:.:....|...|   |.....:||........:||
Zfish   174 HRKSTTLELTSHSVPADHHALYKSRSVSAAKQIPEKPAKRGHVYGGCSTDSSPPSVAVPASPTLS 238

  Fly   600 PSGFSSD-----EVELASQRE 615
            .|..|||     |..|||.:|
Zfish   239 SSAESSDPLSLYEDGLASGKE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 41/70 (59%)
sox4aNP_998287.1 SOX-TCF_HMG-box 63..134 CDD:238684 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582360
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.