DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and HMGB2

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:83 Identity:25/83 - (30%)
Similarity:42/83 - (50%) Gaps:5/83 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 KRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHP 488
            |||.:||.::..:.|.||....|.:...:.:|.||..|...|..|||||.::.::|.:.:.:...
Human    96 KRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIA 160

  Fly   489 DYRYRPRPKRTCIVDGKK 506
            .||.:.:.:.     |||
Human   161 AYRAKGKSEA-----GKK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 22/73 (30%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 19/53 (36%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 20/66 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 5/17 (29%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.