DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox18

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001019952.1 Gene:Sox18 / 311723 RGDID:1311718 Length:377 Species:Rattus norvegicus


Alignment Length:245 Identity:77/245 - (31%)
Similarity:113/245 - (46%) Gaps:39/245 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 SVNSCGTNSERSAALDPESLNSGQLGPV-PASPSSQPLR-----QGNGHGHGGNHGHVHSKPHIK 424
            |...|.......||.:|..|....:.|. ||||||.|..     :...:|.|........:..|:
  Rat    16 SRRDCAWAPGLGAAAEPRGLPVTNVSPTSPASPSSLPRSPPRSPESGRYGFGRGERQTADELRIR 80

  Fly   425 RPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPD 489
            ||||||||||||||:::.:..||:||:.:||:||..||.::.|:|:|:.||..||...|:..||:
  Rat    81 RPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDHPN 145

  Fly   490 YRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACPK----GSG 550
            |:||||.|:    ..:|:|..|..:|:                    .|.:...|.|:    .||
  Rat   146 YKYRPRRKK----QARKVRRLEPGLLL--------------------PGLVQPSAPPEPFAAASG 186

  Fly   551 GSNSQVAVAAAAAVYHLQDMASSAASTAHGHDCGHTPPQQFFYPPESLSP 600
            .:.|...:....|.:....:.:...|...|.:.|..   .||.||  |:|
  Rat   187 SARSFRELPTLGAEFDGLGLPTPERSPLDGLESGEA---SFFPPP--LAP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 36/70 (51%)
Sox18NP_001019952.1 SOX-TCF_HMG-box 78..149 CDD:238684 36/70 (51%)
Sox17_18_mid 191..239 CDD:403331 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.