DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox17

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_571362.2 Gene:sox17 / 30544 ZFINID:ZDB-GENE-991213-1 Length:413 Species:Danio rerio


Alignment Length:233 Identity:74/233 - (31%)
Similarity:106/233 - (45%) Gaps:65/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 DPESLNS---------GQ------LGPVPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAF 430
            ||...:|         ||      |.|:..|.|........|.|.|      .|:|.|:||||||
Zfish    12 DPSQTSSCSSVMMPGMGQCPWVDPLSPLSDSKSKHEKCSAAGPGRG------KSEPRIRRPMNAF 70

  Fly   431 MVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPR 495
            ||||||||:::.:..||:||:.:||:||..|||:...||:|:.||..||...||:.||:|:||||
Zfish    71 MVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALPMVDKRPFVEEAERLRVKHMQDHPNYKYRPR 135

  Fly   496 PKRTCIVDGKKMRISEYKVLMRNRRAE----------MRQLWCRTGGVSGGSGS----LC----- 541
            .:               |.:.||:|.|          .:...|..|..:|.||:    .|     
Zfish   136 RR---------------KQVKRNKRLEPSFPLPGMCDAKMTLCTEGMSAGYSGAGLPQYCENHTL 185

  Fly   542 --------ADACPKGSGGSN--SQVAVAAAAAVYHLQD 569
                    .|..|..:|.:.  :|:...:|.:.:|.|:
Zfish   186 FESYSLPTPDPSPMDAGTTEFFAQLQDQSAFSYHHQQE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)
sox17NP_571362.2 SOX-TCF_HMG-box 62..133 CDD:238684 38/70 (54%)
Sox_C_TAD 186..411 CDD:288887 7/38 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.