DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox8

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001100459.1 Gene:Sox8 / 302993 RGDID:1309072 Length:463 Species:Rattus norvegicus


Alignment Length:387 Identity:93/387 - (24%)
Similarity:136/387 - (35%) Gaps:150/387 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LSYSHNTPPESPHGRTADCSKNFSPSPTDNLSIASVSEAQDSEMDAPLNLSKPKGSPSSSPNSSS 306
            :|.:...||.||.|                 :.:|:|..:||:.|||   ..|.||         
  Rat     4 MSEARAQPPCSPSG-----------------TASSMSHVEDSDSDAP---PSPAGS--------- 39

  Fly   307 QRDHCENLTPVVSSPPLSWHQGQPHYAEIELPLLKSHGRVWNSAVACSGGSRATRVSRDSVNSCG 371
                 |.|                             ||      |..||...|..:.|      
  Rat    40 -----EGL-----------------------------GR------AGGGGRGDTAEAAD------ 58

  Fly   372 TNSERSAALDPESLN------SGQLGPVPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAF 430
               ||..|...::::      ...|.|:|.              .||..|.:.:|||:|||||||
  Rat    59 ---ERFPACIRDAVSQVLKGYDWSLVPMPV--------------RGGGGGTLKAKPHVKRPMNAF 106

  Fly   431 MVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPR 495
            ||||:..|||:....|.:||:.:||.||..|:.:|.::|:|:.||..||...|.:.||||:|:||
  Rat   107 MVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPR 171

  Fly   496 PKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACPKGSGGSNSQVAVAA 560
            .:::                            .:||               :....|.:::....
  Rat   172 RRKS----------------------------VKTG---------------RSDSDSGTELGHHP 193

  Fly   561 AAAVYHLQDMASSAASTAHGHD--CG--HTPPQQFFYPPESL-SPSGFSSDEVELASQRELD 617
            ...:|    ...:....||.|.  .|  |.||.....|...| ..|..|..|:.|..:|.:|
  Rat   194 GGPMY----KTDTVLGDAHRHSDHTGQTHGPPTPPTTPKTDLHQASNGSKQELRLEGRRLVD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 35/70 (50%)
Sox8NP_001100459.1 Sox_N 18..86 CDD:403592 25/142 (18%)
SOX-TCF_HMG-box 98..168 CDD:238684 35/69 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.