DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox14

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001100320.1 Gene:Sox14 / 300954 RGDID:1309654 Length:240 Species:Rattus norvegicus


Alignment Length:178 Identity:71/178 - (39%)
Similarity:93/178 - (52%) Gaps:31/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 SKP--HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSK 481
            |||  ||||||||||||::.:|||:.:..|.||||.|||.|||.||.:|.|:|:||.:|..||..
  Rat     2 SKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRA 66

  Fly   482 LHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACP 546
            .||::||||:||||.|.              |.|::..|......:.      |.:..|.|...|
  Rat    67 QHMKEHPDYKYRPRRKP--------------KNLLKKDRYVFPLPYL------GDTDPLKAAGLP 111

  Fly   547 KG------SGGSNSQVAVAAAAAVYHLQDMA--SSAASTAHGHDCGHT 586
            .|      |....::..:..|:|.|.|.|.|  ||:|....| :..||
  Rat   112 VGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMG-EVPHT 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 42/70 (60%)
Sox14NP_001100320.1 SOX-TCF_HMG-box 7..78 CDD:238684 42/70 (60%)
SOXp 77..>118 CDD:403523 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342371
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.