DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox19a

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_570983.2 Gene:sox19a / 30038 ZFINID:ZDB-GENE-980526-102 Length:297 Species:Danio rerio


Alignment Length:263 Identity:85/263 - (32%)
Similarity:120/263 - (45%) Gaps:76/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 PASPSSQPLRQGNGHGHGGNHGHVHSKP--------------HIKRPMNAFMVWAKDERRKILKA 444
            |...|:|.:.|.||   |..||  .:||              .:||||||||||::.:|||:.:.
Zfish    15 PTHQSAQGMTQLNG---GVTHG--SAKPAVNSQQQQSSDPMDKVKRPMNAFMVWSRGQRRKMAQE 74

  Fly   445 CPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRI 509
            .|.||||.|||.|||.||.:::|:|:|:.:|..||..|||:::|||:|:||.|..          
Zfish    75 NPKMHNSEISKRLGAEWKLLTDAEKRPFIDEAKRLRALHMKEYPDYKYKPRRKTK---------- 129

  Fly   510 SEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADACPKGSGGS---------------NSQVAVA 559
               .||.::..|....|         .:|:|.|.|..:|||||               ..|....
Zfish   130 ---PVLKKDNPAAKYPL---------SAGNLLAAAAAQGSGGSPRMDSYGWGHTGGYPGMQTDAL 182

  Fly   560 AAAAVYHLQDMAS----SAASTAHGHDCG---HTP------PQQ-----FFYPPE--SLSPSGFS 604
            ..:...|..|:::    ||.:||..:..|   :.|      |||     ....||  |.||:|..
Zfish   183 GYSQQLHRYDLSALQYPSAMATAQTYMNGANSYNPMSYSSTPQQPSPVMSMVKPEQVSHSPTGAH 247

  Fly   605 SDE 607
            |.:
Zfish   248 SHQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)
sox19aNP_570983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 11/41 (27%)
SOX-TCF_HMG-box 52..123 CDD:238684 38/70 (54%)
SOXp 122..>187 CDD:289133 18/86 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..255 10/32 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.