DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sry

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_036904.1 Gene:Sry / 25221 RGDID:3759 Length:169 Species:Rattus norvegicus


Alignment Length:99 Identity:43/99 - (43%)
Similarity:67/99 - (67%) Gaps:5/99 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQ 486
            |:||||||||||::.||||:.:..|.|.||.|||.||.:||:::.|:|:|:::|..||..||.|:
  Rat     4 HVKRPMNAFMVWSRGERRKLAQQNPSMQNSEISKHLGYQWKSLTEAEKRPFFQEAQRLKTLHREK 68

  Fly   487 HPDYRYRPR-----PKRTCIVDGKKMRISEYKVL 515
            :|:|:|:|.     |:|:..:..:......|.:|
  Rat    69 YPNYKYQPHRRVKVPQRSYTLQREVASTKLYNLL 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 37/70 (53%)
SryNP_036904.1 Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 4..81 39/76 (51%)
SOX-TCF_HMG-box 4..74 CDD:238684 37/69 (54%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 6..22 12/15 (80%)
Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 52..84 11/31 (35%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 75..81 1/5 (20%)
Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000250|UniProtKB:Q05738 92..144 2/11 (18%)
Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000250|UniProtKB:Q05738 94..138 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..169
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.