| Sequence 1: | NP_001014695.1 | Gene: | Sox102F / 43844 | FlyBaseID: | FBgn0039938 | Length: | 618 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_035694.1 | Gene: | Sry / 21674 | MGIID: | 98660 | Length: | 395 | Species: | Mus musculus |
| Alignment Length: | 197 | Identity: | 61/197 - (30%) |
|---|---|---|---|
| Similarity: | 86/197 - (43%) | Gaps: | 60/197 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 422 HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQ 486
Fly 487 HPDYRYRPR-----PKRTCIVDGKKMRISEYKVLM--RNRRA-EMRQLWCRTGGVSGGSGSLCAD 543
Fly 544 ACPKGSGGSNSQVAVAAAAAVY-----------------HLQDMASSAASTA-HGHDCGHTPPQQ 590
Fly 591 FF 592 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Sox102F | NP_001014695.1 | SOX-TCF_HMG-box | 422..493 | CDD:238684 | 36/70 (51%) |
| Sry | NP_035694.1 | Sufficient for interaction with KPNB1. /evidence=ECO:0000250|UniProtKB:Q05066 | 4..81 | 38/76 (50%) | |
| SOX-TCF_HMG-box | 4..74 | CDD:238684 | 36/69 (52%) | ||
| Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 | 6..22 | 12/15 (80%) | |||
| Sufficient for interaction with EP300. /evidence=ECO:0000250|UniProtKB:Q05066 | 52..84 | 11/31 (35%) | |||
| Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q05066 | 75..81 | 1/5 (20%) | |||
| Necessary for interaction with ZNF208 isoform KRAB-O. /evidence=ECO:0000269|PubMed:15469996 | 92..144 | 13/82 (16%) | |||
| Necessary for interaction with SLC9A3R2 and nuclear accumulation of SLC9A3R2. /evidence=ECO:0000269|PubMed:16166090 | 94..138 | 12/74 (16%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 142..361 | 9/28 (32%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167838569 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||