DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox7

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_035576.1 Gene:Sox7 / 20680 MGIID:98369 Length:380 Species:Mus musculus


Alignment Length:249 Identity:80/249 - (32%)
Similarity:113/249 - (45%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   379 ALDPESLNSGQLGPVPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILK 443
            ||:.| |:.|...|....||                |...|:..|:||||||||||||||:::..
Mouse    18 ALEAE-LSDGLSPPAVPRPS----------------GDKSSESRIRRPMNAFMVWAKDERKRLAV 65

  Fly   444 ACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKM- 507
            ..||:||:.:||:||..|||::.:.|:||.:|..||...||:.:|:|:||||.|:    .||:: 
Mouse    66 QNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLRLQHMQDYPNYKYRPRRKK----QGKRLC 126

  Fly   508 -RISEYKVLMRNRRAEMRQLWCRTG---GVSGGSGSLCADACPKGSGGSNSQVAVAAAAAV---- 564
             |: :...|:.:...:...|..:.|   |.....|.....|...|......:.|.||..:|    
Mouse   127 KRV-DPGFLLSSLSRDQNTLPEKNGIGRGEKEDRGEYSPGATLPGLHSCYREGAAAAPGSVDTYP 190

  Fly   565 YHL---------------QDMASSAASTAHG--HDCGHTPPQQFFYPPESLSPS 601
            |.|               |...||:....||  |...|.|...  |.|| .:||
Mouse   191 YGLPTPPEMSPLDALEPEQTFFSSSCQEEHGHPHHLPHLPGPP--YSPE-FTPS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 36/70 (51%)
Sox7NP_035576.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43 6/34 (18%)
SOX-TCF_HMG-box 44..115 CDD:238684 36/70 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 4/27 (15%)
Sox_C_TAD 175..378 CDD:288887 19/70 (27%)
Required for beta-catenin-binding 323..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.