DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox17

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001276393.1 Gene:Sox17 / 20671 MGIID:107543 Length:419 Species:Mus musculus


Alignment Length:240 Identity:76/240 - (31%)
Similarity:108/240 - (45%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   390 LGPVPASPSSQPLRQGNGHGH--------GGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACP 446
            |||.|.:.|..||......|.        .|..|...::..|:||||||||||||||:::.:..|
Mouse    27 LGPCPWAESLSPLGDVKVKGEVVASSGAPAGTSGRAKAESRIRRPMNAFMVWAKDERKRLAQQNP 91

  Fly   447 DMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISE 511
            |:||:.:||:||..|||::.|:|:|:.||..||...||:.||:|:||||.:              
Mouse    92 DLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPRRR-------------- 142

  Fly   512 YKVLMRNRRAEMRQLWCRTGG-----VSGGSGSLCADACPKGSGGSNSQVAVAAAAAVYHLQDMA 571
             |.:.|.:|.|        ||     |...:|:|    .|:|...:...:.:......|......
Mouse   143 -KQVKRMKRVE--------GGFLHALVEPQAGAL----GPEGGRVAMDGLGLPFPEPGYPAGPPL 194

  Fly   572 SSAASTAHGHDC-GHTPPQQFFYP---PESLSPSGFSSDEVELAS 612
            .|.....|..|| |...|....||   |::....|...|....|:
Mouse   195 MSPHMGPHYRDCQGLGAPALDGYPLPTPDTSPLDGVEQDPAFFAA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)
Sox17NP_001276393.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27 76/240 (32%)
SOX-TCF_HMG-box 67..138 CDD:238684 38/70 (54%)
Sox17_18_mid 203..253 CDD:403331 10/37 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..356
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.