DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox15

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_033261.1 Gene:Sox15 / 20670 MGIID:98363 Length:231 Species:Mus musculus


Alignment Length:239 Identity:73/239 - (30%)
Similarity:98/239 - (41%) Gaps:72/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 ASPSSQPL---RQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKI 456
            ||.:|.||   .|..|...|.:.|....|  :||||||||||:..:||::.:..|.||||.|||.
Mouse    18 ASTASLPLGPQEQEAGGSPGASGGLPLEK--VKRPMNAFMVWSSVQRRQMAQQNPKMHNSEISKR 80

  Fly   457 LGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRA 521
            |||:||.:.:.:|:|:.||..||...|:..:|||:||||         :|.:.|.          
Mouse    81 LGAQWKLLGDEEKRPFVEEAKRLRARHLRDYPDYKYRPR---------RKSKNSS---------- 126

  Fly   522 EMRQLWCRTGGV---SGGSGSLCADACPKGSGGSNSQVAVAAAAAVYHLQDMASSAASTAHGHDC 583
                    ||.|   ..|.|..|        |||:                ......:|......
Mouse   127 --------TGSVPFSQEGGGLAC--------GGSH----------------WGPGYTTTQGSRGF 159

  Fly   584 GHTPP--QQFFYP---------PESLSPSGFSSDEVELASQREL 616
            |:.||  ...:.|         ||:..|..|...:..|  |.||
Mouse   160 GYQPPNYSTAYLPGSYTSSHCRPEAPLPCTFPQSDPRL--QGEL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 35/70 (50%)
Sox15NP_033261.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 9/26 (35%)
Required to promote HAND1 transcriptional activator activity. /evidence=ECO:0000269|PubMed:16759287 1..45 9/26 (35%)
SOX-TCF_HMG-box 46..117 CDD:238684 36/72 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..136 12/51 (24%)
Interaction with FHL3. /evidence=ECO:0000269|PubMed:17363903 136..181 11/68 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..231 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.