DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox12

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_035568.1 Gene:Sox12 / 20667 MGIID:98360 Length:314 Species:Mus musculus


Alignment Length:200 Identity:66/200 - (33%)
Similarity:88/200 - (44%) Gaps:55/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 VNSCGTNSERSAALDPESLNSGQLGPVPASPSSQP---LRQGNGHGHGGNHGHVHSKPHIKRPMN 428
            |...|..::|.....|.       ||.||:..::.   .:..:|              |||||||
Mouse     2 VQQRGARAKRDGGPPPP-------GPGPAAEGAREPGWCKTPSG--------------HIKRPMN 45

  Fly   429 AFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYR 493
            |||||::.|||||:...|||||:.|||.||.||:.:.:::|.|:..|..||...||..:|||:||
Mouse    46 AFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQDSEKIPFVREAERLRLKHMADYPDYKYR 110

  Fly   494 PRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGS-----------GSLCADACPK 547
            ||         ||.:.:..|...|           ..||..|||           |...|...|.
Mouse   111 PR---------KKSKGAPAKARPR-----------PPGGGGGGSRLKPGPQLPGRGGRRASGGPL 155

  Fly   548 GSGGS 552
            |.|.:
Mouse   156 GGGAA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 39/70 (56%)
Sox12NP_035568.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 9/58 (16%)
SOX-TCF_HMG-box 39..110 CDD:238684 39/70 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..287 22/79 (28%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 282..314
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838575
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.