Sequence 1: | NP_001014695.1 | Gene: | Sox102F / 43844 | FlyBaseID: | FBgn0039938 | Length: | 618 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035568.1 | Gene: | Sox12 / 20667 | MGIID: | 98360 | Length: | 314 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 66/200 - (33%) |
---|---|---|---|
Similarity: | 88/200 - (44%) | Gaps: | 55/200 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 367 VNSCGTNSERSAALDPESLNSGQLGPVPASPSSQP---LRQGNGHGHGGNHGHVHSKPHIKRPMN 428
Fly 429 AFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYR 493
Fly 494 PRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGS-----------GSLCADACPK 547
Fly 548 GSGGS 552 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sox102F | NP_001014695.1 | SOX-TCF_HMG-box | 422..493 | CDD:238684 | 39/70 (56%) |
Sox12 | NP_035568.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..40 | 9/58 (16%) | |
SOX-TCF_HMG-box | 39..110 | CDD:238684 | 39/70 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 101..287 | 22/79 (28%) | |||
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 | 282..314 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167838575 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |