DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and Sox1

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_033259.2 Gene:Sox1 / 20664 MGIID:98357 Length:391 Species:Mus musculus


Alignment Length:284 Identity:92/284 - (32%)
Similarity:118/284 - (41%) Gaps:91/284 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PESLNSGQLGPVPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACP 446
            |.:|:    ||..|....     |.|.|.||..|...::..:||||||||||::.:|||:.:..|
Mouse    19 PTNLS----GPAGAGGGG-----GGGGGGGGGGGTKANQDRVKRPMNAFMVWSRGQRRKMAQENP 74

  Fly   447 DMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISE 511
            .||||.|||.|||.||.||.|:|:|:.:|..||..|||::||||:||||.|.             
Mouse    75 KMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKT------------- 126

  Fly   512 YKVLMRNRRAEMRQLWCRTGGV----SGGSGSLCADA---------------CPKGSGGSN---- 553
             |.|::..:..:      .||:    :||.|:..|..               .|.|:.|..    
Mouse   127 -KTLLKKDKYSL------AGGLLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHV 184

  Fly   554 ---------SQVAVAAAAA--------VYHLQDMASSAASTAH-GHDCGHTP------PQQFF-- 592
                     ..||.|||||        .|.....|..|...|| .|...|.|      ||...  
Mouse   185 NGWANGAYPGSVAAAAAAAAMMQEAQLAYGQHPGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRY 249

  Fly   593 ------YPP-------ESLSPSGF 603
                  |.|       .|.||||:
Mouse   250 DMGALQYSPISNSQGYMSASPSGY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 41/70 (59%)
Sox1NP_033259.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 11/41 (27%)
SOX-TCF_HMG-box 50..121 CDD:238684 41/70 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..249 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.