DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox-4

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001335567.1 Gene:sox-4 / 182547 WormBaseID:WBGene00015716 Length:260 Species:Caenorhabditis elegans


Alignment Length:275 Identity:73/275 - (26%)
Similarity:104/275 - (37%) Gaps:103/275 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 YEILSYSHNTPPESPHGRTADCSKNFSPSPTDNL-----------SIASVSEAQDSEMDAPLNLS 292
            :.:.|.:..|.|      .|..|....|..:.|:           ::.|..:..||:     .||
 Worm    10 FNLYSQARKTTP------IAAASSVSCPIVSPNMDATQKLLAIMATVKSFEQVNDSD-----GLS 63

  Fly   293 KPKG--SPSSSPN--SSSQRDHCENLTPVVSSPPLSWHQGQPHYAEIELPLLKSHGRVWNSAVAC 353
            .|..  ||:.|||  ||.|   ...:..::.           ||.                    
 Worm    64 SPSSPESPTESPNVISSVQ---ASTIADIIG-----------HYV-------------------- 94

  Fly   354 SGGSRATRVSRDSVNSCGTNSERSAALDPESLNSGQLGPVPASPSSQPLRQGNGHGHGGNHGHVH 418
            :|.|     .:|.|||    |::||                    |||              ...
 Worm    95 NGNS-----IKDVVNS----SQKSA--------------------SQP--------------RTA 116

  Fly   419 SKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLH 483
            .:|.|||||||||||::..|::|.......|||:|||:|||.|:.|...:|.|:.|...:|.:.|
 Worm   117 REPRIKRPMNAFMVWSQQRRQQIAATGQKFHNSDISKMLGAEWRKMEEHEKVPFVERAKQLREEH 181

  Fly   484 MEQHPDYRYRPRPKR 498
            ...||||.||||.::
 Worm   182 FNAHPDYVYRPRRRK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 33/70 (47%)
sox-4NP_001335567.1 SOX-TCF_HMG-box 120..191 CDD:238684 33/70 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.