DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox-2

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_741836.1 Gene:sox-2 / 181002 WormBaseID:WBGene00004949 Length:283 Species:Caenorhabditis elegans


Alignment Length:120 Identity:51/120 - (42%)
Similarity:70/120 - (58%) Gaps:17/120 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PESLNSGQLGPVPASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACP 446
            |:.|::|     |.||.|.           |..|. .:...:||||||||||::.:|:|:....|
 Worm    36 PDDLSNG-----PDSPDST-----------GKDGK-KNDDRVKRPMNAFMVWSRGQRKKMALENP 83

  Fly   447 DMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCI 501
            .||||.|||.||..||.:|..:|:|:.:|..||..:||::||||:||||.|...|
 Worm    84 KMHNSEISKRLGTEWKMLSEQEKRPFIDEAKRLRAIHMKEHPDYKYRPRRKTKSI 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 40/76 (53%)
sox-2NP_741836.1 HMG-box_SoxB 58..137 CDD:438790 41/78 (53%)

Return to query results.
Submit another query.