DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and hmg-1.2

DIOPT Version :10

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:107 Identity:26/107 - (24%)
Similarity:45/107 - (42%) Gaps:30/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 PHI-KRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSKLHM 484
            ||. ||.::||..:::|:|.:|....||.....:::.||..||.:....|. .||::::..|   
 Worm   132 PHAPKRALSAFFFYSQDKRPEIQAGHPDWKVGQVAQELGKMWKLVPQETKD-MYEQKAQADK--- 192

  Fly   485 EQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQL 526
                                     ..|...|||.:|||:::
 Worm   193 -------------------------DRYADEMRNYKAEMQKM 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 HMG-box_EGL13-like 421..498 CDD:438848 19/77 (25%)
hmg-1.2NP_001380090.1 HMG-box_HMGB_rpt1 44..112 CDD:438794
HMG-box_SF 124..202 CDD:469606 22/98 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.