DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox102F and sox32

DIOPT Version :9

Sequence 1:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster
Sequence 2:NP_571926.1 Gene:sox32 / 116990 ZFINID:ZDB-GENE-011026-1 Length:307 Species:Danio rerio


Alignment Length:118 Identity:49/118 - (41%)
Similarity:71/118 - (60%) Gaps:1/118 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 PASPSSQPLRQGNGHGHGGNHGHVHSKPHIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILG 458
            |||....|:..|:.............:..::||:|||::|.|:|||::.:..||:.|:::|||||
Zfish    41 PASGPLSPVSVGSESSCSSPEAKAPVETRVRRPLNAFIIWTKEERRRLAQLNPDLENTDLSKILG 105

  Fly   459 ARWKAMSNADKQPYYEEQSRLSKLHMEQHPDYRYRPRPKRTCIVDGKKMRISE 511
            ..|||||.|||:||.:|..||...|...:|:|:|||| :|.|.....||..||
Zfish   106 KTWKAMSLADKRPYMQEAERLRIQHTIDYPNYKYRPR-RRKCNKRSSKMPSSE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 34/70 (49%)
sox32NP_571926.1 SOX-TCF_HMG-box 69..140 CDD:238684 34/70 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582325
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.