DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXQ1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_150285.3 Gene:FOXQ1 / 94234 HGNCID:20951 Length:403 Species:Homo sapiens


Alignment Length:248 Identity:85/248 - (34%)
Similarity:112/248 - (45%) Gaps:63/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMA 141
            |..|.||          |..|||.       .|.|.    |.|:|      |||.:|||.|||||
Human    94 GAAGPGA----------GGAGSGE-------GARSK----PYTRR------PKPPYSYIALIAMA 131

  Fly   142 ILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN---GKGHYWAI 203
            |..|...:|.|::|.:|::..:|:||....|||||:||||||||||:|..|..:   ||.:||.:
Human   132 IRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWML 196

  Fly   204 HPANMEDFRKGDFRRRKAQRKVRKHM---GLSVDDASTDSPSPPPLDLTTPPPP----------- 254
            :|.:...|..|.||||:.:...|..:   ||..::|.....:|||.. ..|..|           
Human   197 NPNSEYTFADGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPPPAP-AAPASPRMRSPARQEER 260

  Fly   255 -------SSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHY-----SPPDPA 295
                   ||..|:. |.|..|:....:     |.:|||.|..     .||.||
Human   261 ASPAGKFSSSFAID-SILRKPFRSRRL-----RDTAPGTTLQWGAAPCPPLPA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/86 (49%)
FOXQ1NP_150285.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..75
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..116 11/42 (26%)
FH 119..197 CDD:238016 40/77 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..266 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.