DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXH1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_003914.1 Gene:FOXH1 / 8928 HGNCID:3814 Length:365 Species:Homo sapiens


Alignment Length:203 Identity:59/203 - (29%)
Similarity:87/203 - (42%) Gaps:44/203 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PQTQRIFQP---------EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPG 172
            |:.:...||         ...||.::|:.:||:.|.::...:|.|:.|.:.:...:|:||....|
Human    12 PEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEG 76

  Fly   173 WRNSIRHNLSLNDCFIKSGR---SANGKGHYWAIH----PANMEDFRKGDFRRR----KAQRKVR 226
            |::|||||||.|.||.|..:   ....||::||:.    ||.....:.....||    .|:....
Human    77 WKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFA 141

  Fly   227 KHMGLSVDDASTDSPSPPPLDLTTPPPPSS----QSALQLSALGYPYHQHYIGQFFNRSSAPGMT 287
            |.:|..|   ....|..||   :.|||||.    :|.|..|..|.|:              ||:.
Human   142 KDLGPYV---LHGRPYRPP---SPPPPPSEGFSIKSLLGGSGEGAPW--------------PGLA 186

  Fly   288 HYSPPDPA 295
            ..|.|.||
Human   187 PQSSPVPA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 31/90 (34%)
FOXH1NP_003914.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 3/16 (19%)
FH 33..111 CDD:238016 29/77 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..215 19/61 (31%)
SMAD-interaction domain (SID) 273..354
Fast/FoxH1 motif 1 (FM1) 277..281
Fast/FoxH1 motif 2 (FM2) 287..293
SMAD interaction motif (SIM) 327..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.