DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FKH1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:255 Identity:70/255 - (27%)
Similarity:102/255 - (40%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDN 162
            :|::|.:...:.||    ..:.:.|      ||..||..:|..||||:.:..:.|:|||::|.||
Yeast   282 NGNVPHIENPSDLS----LDENRYI------KPPQSYASMITQAILSTPEGSISLADIYKFISDN 336

  Fly   163 YPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSA--NGKGHYWAIHPANMEDF-------RKGDFRR 218
            |.::|.....|:||:|||||||..|.|..:.|  .|||..|.|......||       :....||
Yeast   337 YAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRR 401

  Fly   219 -RKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSS 282
             ....|:::.||....:..:.:|.|..|..:.......|..|.. |.||              .|
Yeast   402 GASVTRQLQLHMSKFGEIPAPESSSIDPRGIKAQKVKKSLQATS-SILG--------------ES 451

  Fly   283 APGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAYINSTTT---TTIANM 339
            ||                        .:|.|||.         ..|::||:   ||.||:
Yeast   452 AP------------------------QLQRTQLT---------GQISTTTSMDVTTNANV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 38/92 (41%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 70/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46670
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.