DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxc1b

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_571804.1 Gene:foxc1b / 79375 ZFINID:ZDB-GENE-010302-2 Length:433 Species:Danio rerio


Alignment Length:366 Identity:100/366 - (27%)
Similarity:150/366 - (40%) Gaps:121/366 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFP-QTQRIFQPEEP--------KPQH 132
            |.|.:|..||   :|.|.|               :|...:| ...|.:.|..|        ||.:
Zfish    31 GGGYTGMPAP---MSMYSH---------------ATHEQYPGGMARAYGPYAPAQQPKDMVKPPY 77

  Fly   133 SYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN-- 195
            |||.||.|||.:|:|.|:.|:.|||:|::.:|::|....||:||||||||||:||:|..|...  
Zfish    78 SYIALITMAIQNSSDKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKP 142

  Fly   196 GKGHYWAIHPANMEDFRKGDFRRRK---------AQRKVRKHMG---------------LSVDDA 236
            |||.||.:.|.:...|..|.|.||:         .:::.|...|               :.:.|.
Zfish   143 GKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVLREKEDRDRQGKDNPGQACEQDAQQPVKLRDI 207

  Fly   237 STDSPS-PPPLDLTTPP--------------------PPSSQSALQLSAL--------GYPYHQH 272
            .|::.: .||.| :|||                    .|.||:..|..::        |.|.|..
Zfish   208 KTENGACTPPHD-STPPLSTVPKTESPDRSGGSACSGSPQSQTPQQAFSMDTIMTGLRGSPQHAA 271

  Fly   273 YIGQFFNRSSAPGM-----------THYSPP--DPALLMQRQEANNL--------DQTIQPTQLQ 316
            .:..  :|::.||.           .|||||  .||......:|.:|        |.|:.     
Zfish   272 ELPA--SRAALPGSVSLTYSPTPQPAHYSPPCGQPATYHCNMQATSLYTGDRGHGDDTLP----- 329

  Fly   317 QPHSHHQHFAYINSTTTTTIANMF-SQTRKRQFDVASLLAP 356
                     .|.|:|..::|::.. |.:::.|....:.|||
Zfish   330 ---------EYTNTTNASSISHPHQSSSQESQHLQQNRLAP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
foxc1bNP_571804.1 Forkhead 74..160 CDD:278670 43/85 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..250 13/76 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..355 8/50 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.