DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxf1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001039226.1 Gene:foxf1 / 734087 XenbaseID:XB-GENE-478922 Length:373 Species:Xenopus tropicalis


Alignment Length:292 Identity:90/292 - (30%)
Similarity:128/292 - (43%) Gaps:52/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GSLPSVNRMAALSTISLFPQTQR----IFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYI 159
            |..|||...|..:|     :|::    |.:||  ||.:|||.||.|||.||...:|.||:|||::
 Frog    27 GGQPSVMESANCAT-----KTKKTNAGIRRPE--KPPYSYIALIVMAIQSSPTKRLTLSEIYQFL 84

  Fly   160 LDNYPYFRSRGPGWRNSIRHNLSLNDCFIK--SGRSANGKGHYWAIHPANMEDFRKGDFRRR--- 219
            ...:|:||....||:||:|||||||:||||  .|....||||||.|.||:...|.:|.||||   
 Frog    85 QSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMFEEGSFRRRPRG 149

  Fly   220 --------KAQRKVRKHMGL-------SVDDASTDSPSPP---PLD----LTTPPPPSSQSALQL 262
                    |....:...:|.       |...||.....||   .||    :.....||:...:.|
 Frog   150 FRRKCQALKPMYSMMNGLGFNHIPETYSFQGASGTIACPPNSLSLDSGIGMMNGHLPSNVDGMGL 214

  Fly   263 SALGYPYH-------QHYIGQFFNRSSAPGMTHYSPPDPAL----LMQRQEANNLDQTIQPTQLQ 316
            |  |:|..       ..|:|. ...||....:|:....|.|    :|:.....:...:.......
 Frog   215 S--GHPVSHIAANGGHSYMGS-CTGSSGGDYSHHDSGSPLLGGGGVMEPHSVYSSPASAWAPSAS 276

  Fly   317 QPHSHHQHFAYINSTTTTTIANMFSQTRKRQF 348
            .|:...|..:..||......:::.|.:..:.:
 Frog   277 TPYIKQQPLSPCNSAANPLSSSLSSHSLDQSY 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 47/85 (55%)
foxf1NP_001039226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 8/28 (29%)
Forkhead 53..139 CDD:365978 47/87 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..306 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.