DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxq1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_002934447.2 Gene:foxq1 / 733448 XenbaseID:XB-GENE-483842 Length:437 Species:Xenopus tropicalis


Alignment Length:237 Identity:81/237 - (34%)
Similarity:111/237 - (46%) Gaps:40/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGR 192
            |||.:|||.||||||..|...:|.|::|..|::..:|:||....|||||:||||||||||:|..|
 Frog   110 PKPPYSYIALIAMAIKDSASGRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLR 174

  Fly   193 SAN---GKGHYWAIHPANMEDFRKGDF-RRRKAQRKVRK--------------HMGLSVDDAST- 238
            ..:   ||.:||.::|.:...|..|.| ||||...:|.|              |..::...||. 
 Frog   175 DPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLNRVTKCLKEQDLQGLAEQQHQMMNPTKASQG 239

  Fly   239 DSPSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRS-------SAPGMTHYSPPDPAL 296
            .|||...| :..|..|||.|.  .|:......:...|..|:.|       |.|.......|||  
 Frog   240 SSPSSSRL-IMAPSAPSSSST--NSSSNRSAKETNSGTKFSSSFAIESILSKPFQRREREPDP-- 299

  Fly   297 LMQRQEANNLDQTIQPT--QLQQPHSHHQHFAYINSTTTTTI 336
               |..:..:   :.||  .|..| |....:..::.|.:||:
 Frog   300 ---RSSSGRI---LWPTGALLHSP-SSAPSYPIVSYTPSTTL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/86 (49%)
foxq1XP_002934447.2 FH_FOXQ1-like 111..189 CDD:410808 40/77 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.