DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxk2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_011247520.1 Gene:Foxk2 / 68837 MGIID:1916087 Length:690 Species:Mus musculus


Alignment Length:434 Identity:126/434 - (29%)
Similarity:165/434 - (38%) Gaps:131/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYGGTGGSGASAPWLHLSPY 93
            ||..|:|.||           |:.:......|      |..|..|.  ||..:..|.|   .||.
Mouse   203 KPVQPHISPL-----------TINIPDTMAHL------ISPLPSPT--GTISAANSCP---SSPR 245

  Fly    94 GHHGSGSLPSVNRMAALSTISLFPQTQRIFQPE-------------EPKPQHSYIGLIAMAILSS 145
            |...||.  .|.|:.. |.:||.....   |||             :.||.:||..||..||..:
Mouse   246 GAGSSGY--KVGRVMP-SDLSLMADNS---QPENEKEASGGDSPKDDSKPPYSYAQLIVQAITMA 304

  Fly   146 TDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANM 208
            .|.:|.|:.||.:|..||||:|:...||:||||||||||..|||..||..  |||.:|.|.||:.
Mouse   305 PDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASE 369

  Fly   209 EDFRKGDFRRRK--------------AQRKV---RKHMG-LSVDDASTDSP-------SPPPLDL 248
            ....:..||:|:              :.|..   ..|.| ||...:...:|       ||.||: 
Mouse   370 SKLVEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLE- 433

  Fly   249 TTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPT 313
              |.|.:||..|.:           |.:.....||||....|.| ..:.:|||    |...|:| 
Mouse   434 --PEPGASQPKLAV-----------IQEARFAQSAPGSPLSSQP-VLITVQRQ----LPPAIKP- 479

  Fly   314 QLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSVTPTTS- 377
                          :..|..|.:....||            .|.||.|.:|.:....|||.... 
Mouse   480 --------------VTYTVATPVTTPTSQ------------PPVVQTVHVVHQIPAVSVTSVAGL 518

  Fly   378 --ARTTTQTHHTVITKQTI-------------HREVVLGLEKPV 406
              |.|.|.....|:|:..:             ||||.:.:| ||
Mouse   519 APANTYTVAGQAVVTQAAVLAPPNPEPQENGDHREVRVKVE-PV 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
Foxk2XP_011247520.1 FHA 41..>124 CDD:238017
COG5025 <175..>381 CDD:227358 73/205 (36%)
Forkhead 287..373 CDD:365978 43/85 (51%)
PHA03247 <380..683 CDD:223021 53/229 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.