DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxl1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:289 Identity:85/289 - (29%)
Similarity:128/289 - (44%) Gaps:71/289 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 MAALSTISLFPQTQRIFQPEEP----------------------KPQHSYIGLIAMAILSSTDMK 149
            :|||:...|.    .::.||.|                      ||.:|||.||||||..:.:.:
  Rat     9 LAALAASPLL----YVYSPERPGLPLAFAPATALAGPGRVEPPQKPPYSYIALIAMAIQDAPEQR 69

  Fly   150 LVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFR 212
            :.|:.|||:|:|.:|::.....||:||||||||||:||:|..|...  |||.||.:.|..::.|.
  Rat    70 VTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPREKGRPGKGSYWTLDPRCLDMFE 134

  Fly   213 KGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQLS----ALGYPYHQHY 273
            .|::||||  ||.:...|            .|....|...|..|:....:.    |...|.|:. 
  Rat   135 NGNYRRRK--RKPKPAAG------------SPEAKRTRVEPRESEVGCDVGSPNLATARPMHEP- 184

  Fly   274 IGQFFNRSSAP--GMTHYSP----PDPALLMQRQEANNLDQTIQPT------QLQQPHSHHQHFA 326
                 :||.:|  |.|..|.    |.|.|     ...:.|:|||..      ||::|..:..|  
  Rat   185 -----DRSQSPAAGGTARSALLPWPGPEL-----RDPDADRTIQDAGAVASGQLERPVHYPVH-- 237

  Fly   327 YINSTTTTTIANMFSQTRKRQFDVASLLA 355
            ::.|:.....:.....::.:.|.:.|:||
  Rat   238 HLGSSLRPAPSGSPKGSKSKSFSIDSILA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 41/85 (48%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 41/87 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.