DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXL2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:326 Identity:88/326 - (26%)
Similarity:120/326 - (36%) Gaps:129/326 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP----KPQHS 133
            |..||.||.|.:                                        ||:|    ||.:|
Human    34 PGKGGGGGGGTA----------------------------------------PEKPDPAQKPPYS 58

  Fly   134 YIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSANG-- 196
            |:.||||||..|.:.:|.||.|||||:..:|::.....||:||||||||||:||||..|...|  
Human    59 YVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGER 123

  Fly   197 KGHYWAIHPANMEDFRKGDFRRRKAQRKVRK----HM--------------GLSVDDASTDS--- 240
            ||:||.:.||..:.|.||::|||:..::..:    |.              |..|..|..|.   
Human   124 KGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVAGAGADGYGY 188

  Fly   241 PSPPPL----------DLTTPPPPSSQSALQLSAL-------------GYPYHQHYI-------- 274
            .:||..          .|..||.|...::.|::|.             |.|.....:        
Human   189 LAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAA 253

  Fly   275 --GQFFNRSS---APGMTH---------YSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHF 325
              |.:....|   .||:.:         .:||.|                 |.....||:||.|.
Human   254 SYGPYTRVQSMALPPGVVNSYNGLGGPPAAPPPP-----------------PHPHPHPHAHHLHA 301

  Fly   326 A 326
            |
Human   302 A 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 9/58 (16%)
Forkhead 53..139 CDD:365978 44/85 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.