DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXD4L5

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001119806.1 Gene:FOXD4L5 / 653427 HGNCID:18522 Length:416 Species:Homo sapiens


Alignment Length:341 Identity:100/341 - (29%)
Similarity:141/341 - (41%) Gaps:87/341 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NVPKPSLPNIYPLGTTRTSQAQSTTMTL--------------EQYRLQLYNYALNIERLRCPQYG 76
            |:|:...|...|..:.|.|..:...:.:              |:.|.|....:|. ..|:..::|
Human     2 NLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEARQQFLEQSLQ-PGLQVARWG 65

  Fly    77 GT--------GGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHS 133
            |.        ||.|.|.|    |.:|    ....:..|.||.|..:..|          .||.:|
Human    66 GVALPREHIEGGGGPSDP----SEFG----TKFRAPPRSAAASEDARQP----------AKPPYS 112

  Fly   134 YIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--G 196
            ||.||.||||.:...:|.||.|..:|...:||:|.:.|.|:|||||||||||||:|..|...  |
Human   113 YIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPG 177

  Fly   197 KGHYWAIHPANMEDFRKGDFRRRKAQRKVRKH-----------MGLSVDDASTDSPSPPPLDLTT 250
            ||:||::.||:.:.|..|.|.||:  ::.::|           ..|....|:..:|.|.|| |..
Human   178 KGNYWSLDPASQDMFDNGSFLRRR--KRFKRHQLTPGAHLPHPFPLPAAHAALHNPHPGPL-LGA 239

  Fly   251 PPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYS--PPDPA--LLMQR-------QEAN 304
            |.||.....      .||            ::|||...|:  .|.|.  ||:..       ::|.
Human   240 PAPPQPVPG------AYP------------NTAPGRCPYALLHPHPLRYLLLSAPVYAGAPKKAE 286

  Fly   305 NLD-QTIQPTQLQQPH 319
            ..| .|..|.....||
Human   287 GADLATPAPFPCCSPH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
FOXD4L5NP_001119806.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 9/52 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 11/42 (26%)
Forkhead 108..194 CDD:278670 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.