DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXD4L6

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001078945.1 Gene:FOXD4L6 / 653404 HGNCID:31986 Length:417 Species:Homo sapiens


Alignment Length:248 Identity:82/248 - (33%)
Similarity:112/248 - (45%) Gaps:62/248 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LRCPQYGGT--------GGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPE 126
            |:..::||.        ||.|.|.|    |.:|    ....:..|.||.|..:..|         
Human    59 LQVARWGGVALPREHIEGGGGPSDP----SEFG----TKFRAPPRSAAASEDARQP--------- 106

  Fly   127 EPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSG 191
             .||.:|||.||.||||.:...:|.||.|..:|...:||:|.:.|.|:|||||||||||||:|..
Human   107 -AKPPYSYIALITMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIP 170

  Fly   192 RSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKH-----------MGLSVDDASTDSPSP 243
            |...  |||:||::.||:.:.|..|.|.||:  ::.::|           ..|....|:..:|.|
Human   171 REPGHPGKGNYWSLDPASQDMFDNGSFLRRR--KRFKRHQLTPGAHLPHPFPLPAAHAALHNPHP 233

  Fly   244 PPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYS--PPDP 294
            .|| |..|.||.....      .||            ::|||...|:  .|.|
Human   234 GPL-LGAPAPPQPVPG------AYP------------NTAPGRRPYALLHPHP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
FOXD4L6NP_001078945.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 11/42 (26%)
Forkhead 108..194 CDD:278670 44/85 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.