Sequence 1: | NP_651951.1 | Gene: | fd102C / 43843 | FlyBaseID: | FBgn0039937 | Length: | 599 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_068699.1 | Gene: | Foxj2 / 60611 | MGIID: | 1926805 | Length: | 565 | Species: | Mus musculus |
Alignment Length: | 397 | Identity: | 99/397 - (24%) |
---|---|---|---|
Similarity: | 137/397 - (34%) | Gaps: | 155/397 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 IERL-RCPQYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKP 130
Fly 131 QHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN 195
Fly 196 --GKGHYWAI-----------HPANMEDFRKGDFRRRKAQRKVR-----------KHMGL----- 231
Fly 232 --------------SVDDASTDSPSP--------PPLDLTTPPPPSSQSALQLSALGYPYHQHYI 274
Fly 275 GQFFNRSSA------------PGMTHY--------------SPPDPALLMQRQEA-----NNL-- 306
Fly 307 -----------------------------DQTIQPTQLQ----QPHSHHQHF------------- 325
Fly 326 -AYINST 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd102C | NP_651951.1 | Forkhead | 129..213 | CDD:278670 | 46/96 (48%) |
Foxj2 | NP_068699.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 29..61 | 10/52 (19%) | |
Forkhead | 66..143 | CDD:278670 | 42/76 (55%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 125..233 | 22/109 (20%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 290..399 | 19/108 (18%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 543..565 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |