DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxg1c

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:213 Identity:72/213 - (33%)
Similarity:105/213 - (49%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PQTQRIFQPEE----PKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSI 177
            |:.:....||:    .||..||..||.|||..|.:.:|.|:.||::|:.|:||:|....||:|||
Zfish    74 PKCEGTDVPEKKSKPDKPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYRENRQGWQNSI 138

  Fly   178 RHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDF---RKGDFRRR-----KAQRKVRKHMGLS 232
            |||||||.||:|..|..:  |||:||.:.|::.:.|   ..|..|||     :|:..:::...||
Zfish   139 RHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTAASRAKLAMKRGARLS 203

  Fly   233 VDDASTDS--------PSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHY 289
            ...||...        |.||  .:|.....||.:|        .:|.:|.....::|:    .|:
Zfish   204 STAASAGLAFAGSFYWPVPP--FVTLQHRHSSPAA--------AHHSNYAASVLSQSA----RHF 254

  Fly   290 SPPDPA----LLMQRQEA 303
            |...||    |:...|||
Zfish   255 SSVAPAAERLLIPSSQEA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/88 (48%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 42/87 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.