DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxe1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_005159967.1 Gene:foxe1 / 567676 ZFINID:ZDB-GENE-061116-1 Length:354 Species:Danio rerio


Alignment Length:258 Identity:80/258 - (31%)
Similarity:112/258 - (43%) Gaps:75/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRS 193
            ||.:|||.||:|||.:|.|.||.|..||::|.:.:|::|.....|:|||||||:|||||||..|.
Zfish    40 KPPYSYIALISMAIANSPDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPRE 104

  Fly   194 AN--GKGHYWAIHPANMED-FRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPS 255
            ..  |||:|||:.| |.|| |..|.|.||      ||....|              |.||     
Zfish   105 PGRPGKGNYWALDP-NAEDMFESGSFLRR------RKRFKRS--------------DFTT----- 143

  Fly   256 SQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPP-DPALLMQRQEANNL--DQTIQPTQLQQ 317
                          :..|:             |.||. .|..:.:...||::  :..:.|...||
Zfish   144 --------------YSSYV-------------HESPVFSPVQIARSAYANSVYSNMAVSPPYAQQ 181

  Fly   318 PHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSVTPTTSART 380
            ..|     ||..|::..     |:..:.|.|.:.||:....::      .|.:.:.|..|.|:
Zfish   182 LPS-----AYYQSSSPN-----FTAGQSRVFRINSLIGSPSRM------GQNAEMIPQQSCRS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 47/86 (55%)
foxe1XP_005159967.1 FH 40..128 CDD:214627 47/88 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.