DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxb2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_005162532.1 Gene:foxb2 / 559714 ZFINID:ZDB-GENE-081104-320 Length:318 Species:Danio rerio


Alignment Length:238 Identity:76/238 - (31%)
Similarity:108/238 - (45%) Gaps:64/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSG 191
            :.||.:|||.|.||||.|.::..|.|||||::|:|.:||:|.....|:||:|||||.||||||..
Zfish    11 DQKPPYSYISLTAMAIQSCSEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIP 75

  Fly   192 RSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPP 254
            |..:  |||.:||:||...:.|..|.|.||:.:.|:     |.|:                    
Zfish    76 RRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKL-----LRVE-------------------- 115

  Fly   255 SSQSALQLSALGYPYH-----QHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQ 314
              .||.:.|.|.:.||     ||.:.|..:.|...|:.|   |:....|.|.             
Zfish   116 --HSACKSSPLLHSYHSHHHTQHSLHQSHHHSGKLGVGH---PEYLGTMGRL------------- 162

  Fly   315 LQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPD 357
                 ||.|.:         |::...:.:.|..|.:.||:..|
Zfish   163 -----SHFQSY---------TLSGGQTGSFKHPFAIESLIGRD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
foxb2XP_005162532.1 FH 13..101 CDD:214627 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.