DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxj1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:452 Identity:105/452 - (23%)
Similarity:163/452 - (36%) Gaps:130/452 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TTTADQDQGTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQY 75
            |..|:.:||..|..|:|              ....:.::...|:::.:      ||....:.|..
 Frog    92 TFQAEGEQGQDSFSSSV--------------NLDDSLTSLQWLQEFSI------LNANVGKAPSS 136

  Fly    76 GGTGG----SGASAPWLHLSP--YGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP--KPQH 132
            |.:.|    |||....|...|  .|...:...|..:..:..|.:.|.|. :.|.....|  ||.:
 Frog   137 GDSHGYKHLSGAPCSPLAADPACLGMPHTPGKPISSSTSRASHLGLQPM-EDIDYKTNPHVKPPY 200

  Fly   133 SYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN-- 195
            ||..||.||:.:|...|:.||.||::|.||:.|||...|.|:||||||||||.||||..|..:  
 Frog   201 SYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEP 265

  Fly   196 GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSAL 260
            |||.:|.|.|...:....|..::|:.                      ||:.:    .|:..|| 
 Frog   266 GKGGFWKIDPQYADRLMNGAMKKRRL----------------------PPVQI----HPAFASA- 303

  Fly   261 QLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHF 325
            |.:|.|..          ||.| |.....:.....||.:.:||..                .|.:
 Frog   304 QAAASGNS----------NRGS-PWQLSVNSESHQLLKEFEEATG----------------EQGW 341

  Fly   326 AYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQES-------------------- 370
            ..:.......|::..|..||:........||.:....::.:::::                    
 Frog   342 NALGEHGWNAISDGKSHKRKQPLPKRMFKAPRLSSSPMLCQEEQTELGSLKGDFDWEVIFDSSMN 406

  Fly   371 ----------SVTPTTSARTTTQTHHTVITKQTIHREVV--------LGLEKPVQDADIDAD 414
                      .|||..|..|.:       ...|:|.:.:        ||.::.|....:|.|
 Frog   407 GVNFSAFEDLEVTPPLSPVTRS-------VDLTVHGKHIDCPQQWYPLGQDQAVVQNSLDFD 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 43/85 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.