DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxd1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:384 Identity:100/384 - (26%)
Similarity:143/384 - (37%) Gaps:136/384 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDICALQTT-----TADQDQGTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNY 63
            ||:.|.:|.     ..|:.:.....|.::....||         ||...|.|.            
 Frog     8 SDVLAEETDIDVVGEDDEPRAEEEEDEDLHGDLLP---------TSPQSSATK------------ 51

  Fly    64 ALNIERLRCPQYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP 128
                     ..|.||||.|              |..:|                          .
 Frog    52 ---------DPYKGTGGGG--------------GRSAL--------------------------V 67

  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRS 193
            ||.:|||.||.||||.|...:|.||:|.::|.:.:||:|.:.|.|:|||||||||||||:|..|.
 Frog    68 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 132

  Fly   194 AN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPP---P 253
            ..  |||:||.:.|.:.:.|..|.|.||:.:.|.::               .|.|.|..|.   |
 Frog   133 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQ---------------APELVLREPGHFLP 182

  Fly   254 PSSQS--------ALQLSALGYPYHQHYIGQFFN------RSSAPGMTHYSPPDPALLMQRQEAN 304
            .|:.|        .:||.    |:|.|.....|.      |...|.:    ||..|..:....|.
 Frog   183 ASAYSYGPYSCAYGIQLQ----PFHPHSALIAFQQQQQQARQQPPSL----PPMAAPALMPPAAQ 239

  Fly   305 NLDQ--TIQPTQLQQ---PHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDV 358
            :|.:  |..|.||..   |.|       :.|.:::.:|       :..|.:.|::..|:
 Frog   240 DLSRTCTFYPHQLSPAALPPS-------LQSKSSSALA-------RSTFSIESIIGGDL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 18/98 (18%)
Forkhead 68..153 CDD:365978 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.