DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxj2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_031760837.1 Gene:foxj2 / 448174 XenbaseID:XB-GENE-483646 Length:522 Species:Xenopus tropicalis


Alignment Length:248 Identity:80/248 - (32%)
Similarity:103/248 - (41%) Gaps:53/248 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GGSGASAPWL------------HLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQ 131
            |.|..|..||            ..:..|..|.||....:.|.:         .:......:.||.
 Frog    16 GSSLTSIDWLPQLTIQAAMKGSQQNNAGRKGPGSPTDPSAMLS---------KEEAAAHRDGKPP 71

  Fly   132 HSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN- 195
            :||..||..||.|:...::.||:||::|.||:||:|:.|.||:||||||||||.||.|..|..: 
 Frog    72 YSYANLIQYAINSAPAKRMTLSEIYRWICDNFPYYRNAGVGWKNSIRHNLSLNKCFRKVPRPRDD 136

  Fly   196 -GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPP--PPSSQ 257
             |||.||.|.....||..   ..|||     |.|..   |:.|.||...   |:...|  ..|..
 Frog   137 PGKGSYWMIDSCPKEDVA---LPRRK-----RPHPD---DEVSQDSFEQ---DVNKSPLRSASEV 187

  Fly   258 SALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEA---NNLD 307
            |..|....|:|.:        |.|..|.   ||..:|..:.....|   ||.|
 Frog   188 SMPQEGTQGHPMN--------NNSPLPS---YSQANPTQMPPDSRAPTYNNND 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
foxj2XP_031760837.1 FH_FOXJ2 68..149 CDD:410825 42/80 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.