DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and fd96Cb

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:248 Identity:70/248 - (28%)
Similarity:101/248 - (40%) Gaps:78/248 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 EPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSG 191
            :.||.:|||.|.||||:.|....|.||:||::|:|.:|::|.....|:||:|||||.||||||..
  Fly    11 DQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVP 75

  Fly   192 RSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPP 254
            |:..  |||.||.:||...:.|..|...||:.:.:|::   |..|.::....:....::.|    
  Fly    76 RNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQ---LEKDISNWKLAAAANTEMVT---- 133

  Fly   255 SSQSALQLSALGYPYHQHYI---------------GQFFNRSSAPGMTHYSPPDPALLMQRQEAN 304
                             ||:               |.....:||..|:.|....|.|        
  Fly   134 -----------------HYLDDQLTQMAFADPARHGHVLANASAAQMSPYKATPPIL-------- 173

  Fly   305 NLDQTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPD 357
                   ||.:.|                      .....||.|.:.||:|||
  Fly   174 -------PTTVTQ----------------------LPARPKRAFTIESLMAPD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 43/87 (49%)
Alpha_kinase 106..>194 CDD:295997 20/148 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445539
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46670
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.