DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxf2a

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001077284.1 Gene:foxf2a / 407681 ZFINID:ZDB-GENE-110407-5 Length:383 Species:Danio rerio


Alignment Length:334 Identity:86/334 - (25%)
Similarity:120/334 - (35%) Gaps:116/334 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SLPSVNRMAALSTISLFPQTQRIFQ------------------PEEPKPQHSYIGLIAMAILSST 146
            |.|:.|.|.     |....||.:.:                  ||  ||.:|||..|.|||.||.
Zfish    18 SSPASNSMH-----SALQNTQTVLESTTATGNKGKKSNSGMRRPE--KPPYSYIAPIVMAIQSSP 75

  Fly   147 DMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIK--SGRSANGKGHYWAIHPANME 209
            ..:|.||:|||::...:|:||....||:||:|||||||:||||  .|....||||||.|.|.:..
Zfish    76 TKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPGSEF 140

  Fly   210 DFRKGDFRRRKA--QRKVR---------------------------------------------- 226
            .|.:|.||||..  :||.:                                              
Zfish   141 MFEEGSFRRRPRGFRRKCQALKPMYRMMNGIGFGASMLPQNFDFQSPSASLACHANSYNLDMMSN 205

  Fly   227 ------------------KHMGLSVDD--------ASTDSPSPPPLDLTTPPPPSSQSALQLSAL 265
                              .||..|...        ||.....|...:.....||:...:|:..: 
Zfish   206 AVQGVHAGYDGLGAGHHVSHMSPSTGSTYMTACQVASNGEYGPDSSNSPLHSPPTMSGSLECHS- 269

  Fly   266 GYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAYINS 330
              ||     |......::.|::.|....| |......::.|..::.|..|:|.:.||      |.
Zfish   270 --PY-----GAASAHGASSGVSPYIKQQP-LSSSSPTSSGLHSSMPPYSLEQSYLHH------NG 320

  Fly   331 TTTTTIANM 339
            ..:..|:.|
Zfish   321 RDSADISGM 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
foxf2aNP_001077284.1 FH 58..146 CDD:214627 45/87 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.