DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxg1b

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:200 Identity:72/200 - (36%)
Similarity:95/200 - (47%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 EEP-----------KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRH 179
            |||           ||..||..||.|||..|.:.:|.|:.||::|:.|:||:|....||:|||||
Zfish    63 EEPELQTKKGKKFDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGWQNSIRH 127

  Fly   180 NLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDF---RKGDFRRRKAQRKVRKHMGLSVDDASTD 239
            |||||.||:|..|..:  |||:||.:.|::.:.|   ..|..|||.|..:.:..|...:..|   
Zfish   128 NLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSATSRGKLVMKRGLRFA--- 189

  Fly   240 SPSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQ---FFNRSSA-----PGMTHYSPPDPAL 296
                 ||.|.....||:....|||.....:|.||.|.   |.|:...     ||:......|   
Zfish   190 -----PLGLGLGERPSNPLYWQLSPFLPLHHSHYNGSAHGFLNQGHTYGTLLPGVEPLGNGD--- 246

  Fly   297 LMQRQ 301
             |.||
Zfish   247 -MSRQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/88 (48%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 42/87 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.