DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxq1b

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_998072.1 Gene:foxq1b / 405843 ZFINID:ZDB-GENE-040426-2090 Length:283 Species:Danio rerio


Alignment Length:328 Identity:93/328 - (28%)
Similarity:144/328 - (43%) Gaps:90/328 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLI 138
            :.|..|...|::|          |.|: |..:..|.       |.|:|      |||.:|||.||
Zfish    14 ELGSDGDCSANSP----------GPGA-PVPDGKAK-------PYTRR------PKPPYSYIALI 54

  Fly   139 AMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN---GKGHY 200
            ||||..|...:|.|::|.:|::..:|:||....|||||:||||||||||:|..|..:   ||.:|
Zfish    55 AMAIRDSNTGRLTLAEINEYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRDPSRPWGKDNY 119

  Fly   201 WAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPP-------SSQS 258
            |.::|.:...|..|.||||: :|..:|.:|      |.:||...|.|.:..|..       ||..
Zfish   120 WMLNPHSEYTFADGVFRRRR-KRISKKILG------SAESPERVPADDSRLPARDESVSKFSSSF 177

  Fly   259 ALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQ 323
            |:. |.|..|:                            |:|:::.: |.....|:|..  |...
Zfish   178 AID-SILSKPF----------------------------MRREQSTD-DTCFGTTRLMM--SAAP 210

  Fly   324 HFAYI--------NSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSVTPTTSART 380
            ||..:        ....::.::|:|...|....|::::    .::.||     :||:.....:.|
Zfish   211 HFLPVAMGFPPQSRFQVSSEVSNVFPIYRCNTADISNI----SRMADI-----QSSLPGLAHSHT 266

  Fly   381 TTQ 383
            |.|
Zfish   267 TLQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/86 (49%)
foxq1bNP_998072.1 FH 45..134 CDD:214627 42/88 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.