DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxa2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_989423.1 Gene:foxa2 / 395063 XenbaseID:XB-GENE-480476 Length:434 Species:Xenopus tropicalis


Alignment Length:343 Identity:99/343 - (28%)
Similarity:149/343 - (43%) Gaps:62/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLGTTRTSQAQSTT--MTLEQYRLQLYNYALNIERLRCPQYGG--------TG-GSGASAPWLHL 90
            |:.|..:..|.||:  ||.....:...|..::      |...|        || |:|.::...||
 Frog    39 PMNTYMSMSAMSTSANMTAGSMNMSYVNTGMS------PSLTGMSPGTGAMTGMGTGVASMASHL 97

  Fly    91 SPYGHHGSGSLPSVNRMAALSTIS----LFPQTQRIFQPEEP----------KPQHSYIGLIAMA 141
            ||.....|....|:|.:|..:.::    ::.|: .|.:..:|          ||.:|||.||.||
 Frog    98 SPSMSPMSAQATSMNALAPYTNMNSMSPIYGQS-NINRSRDPKTYRRSYTHAKPPYSYISLITMA 161

  Fly   142 ILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIH 204
            |..|.:..|.||:|||:|:|.:|::|.....|:|||||:||.||||:|..||.:  |||.:|.:|
 Frog   162 IQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLH 226

  Fly   205 PANMEDFRKGDFRRRKAQRKVRKHMGL-------------SVDDASTDSP-----SPPPLDLTTP 251
            |.:...|..|.:.||:.:.|..|...|             ||..|:..|.     :..|...::|
 Frog   227 PDSGNMFENGCYLRRQKRFKCEKKPSLREGGGKKLSEGSSSVGSAANSSSESSVGNESPHSSSSP 291

  Fly   252 PPPSSQSALQL-SALGY-PYH--------QHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNL 306
            .....:|.:.: |:.|. |.|        ||.:.|..:..|....:|..|............|||
 Frog   292 CQEQKRSLVDMKSSQGLSPDHAASPASQAQHLLSQHHSVLSHEAQSHLKPEHHYSFNHPFSINNL 356

  Fly   307 DQTIQPTQLQQPHSHHQH 324
            ..:.|.......|:||.|
 Frog   357 MSSEQQHHHHHHHNHHHH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
foxa2NP_989423.1 Forkhead_N 17..148 CDD:369872 25/115 (22%)
FH 149..237 CDD:214627 43/87 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..339 17/89 (19%)
HNF_C 349..423 CDD:370449 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.