DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FoxK

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:411 Identity:106/411 - (25%)
Similarity:153/411 - (37%) Gaps:121/411 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 QDQGTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYGGTG- 79
            |.|....:.::.|.|..|: :||..|...|.|..:.::                :..|..|... 
  Fly   326 QQQQQQQQPAHHPLPHTPH-HPLHHTALHQQQQRSGSI----------------VVAPPAGAAAH 373

  Fly    80 -----GSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQ------------------TQR 121
                 |.|..:|.....|.....|..|.....::|.::....|:                  ||.
  Fly   374 LIAGDGPGIYSPLKISIPKKEQKSPYLSPTGTISAANSCPASPRQGFIQNQPNNYNNYGNNNTQD 438

  Fly   122 IFQP-------EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSR-GPGWRNSIR 178
            :||.       ...||.:||..||..||.::.|.:|.||.||.:|:.:|||:|.. ..||:||||
  Fly   439 LFQTPSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIR 503

  Fly   179 HNLSLNDCFIKSGRSAN--GKGHYWAIHP---ANMED--FRKGDFRRRKAQRKVRKHMGLSVDDA 236
            ||||||..|||..||.:  |||.:|.|.|   |.:.|  ::|   ||:::.:..|...|:     
  Fly   504 HNLSLNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKK---RRQRSSQGFRPPYGM----- 560

  Fly   237 STDSP-SPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMT-HYSPPDPALLMQ 299
            ...:| ||..:|.:....|.....|| ||.|                :|||: .....||.::..
  Fly   561 PRSAPVSPSHMDNSRESSPLQDIVLQ-SAPG----------------SPGMSLEQRAADPEIIYN 608

  Fly   300 RQEANNLDQTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIV 364
            .|.|:...|..|..|.||                 |::|..:|                     .
  Fly   609 SQNAHQQQQQQQQQQQQQ-----------------TLSNNSNQ---------------------Y 635

  Fly   365 SEDQESSVTPTTSARTTTQTH 385
            |......||..:|...|.|||
  Fly   636 SSGSPYYVTNQSSGVATPQTH 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/91 (48%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 43/86 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445541
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.