DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxi3b

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_944600.1 Gene:foxi3b / 387258 ZFINID:ZDB-GENE-031126-4 Length:383 Species:Danio rerio


Alignment Length:403 Identity:109/403 - (27%)
Similarity:150/403 - (37%) Gaps:131/403 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CALQTTTADQDQGTSS--RDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYA----- 64
            |..|..:..|:....|  .||..|.||||:  |..|..:|             .:|.:||     
Zfish    14 CGPQFLSLGQEPPELSLYSDSYYPPPSLPS--PQRTNPSS-------------YELGDYAASSPN 63

  Fly    65 ---------LNIERLRCPQYGGTGGS----------GASAPWLHLSPYGHHGSG----SLPSVNR 106
                     :|    ..|..|||.|.          |...|:|...|.|..|..    |:||...
Zfish    64 PYLWFNSPGMN----SAPYLGGTPGPAGPSFVPQHYGMQRPYLGPGPPGGPGGELSWFSMPSQED 124

  Fly   107 MAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGP 171
            :..|                 .:|.:||..||||||..:.:.:|.||.||||:.||:|::.....
Zfish   125 LMKL-----------------VRPPYSYSALIAMAIHGAPERRLTLSQIYQYVADNFPFYNKSKA 172

  Fly   172 GWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQR------KVRKH 228
            ||:|||||||||||||.|..|..:  |||:||.:.|...:.|..|:|||::.::      |....
Zfish   173 GWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDSLPEKSSSG 237

  Fly   229 MGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPD 293
            ...|.|.....||....:|::|.|                          .:..:|..|   .|.
Zfish   238 GNESGDSNGRGSPKSQSIDISTSP--------------------------EKGPSPAST---GPS 273

  Fly   294 PALL-----MQRQEANNLDQTIQPTQLQQPHS----------HHQHFAYINSTTTTTIANMFSQT 343
            |.|.     |....|.:||....|  |.:|.:          ..|...:...|.:||::      
Zfish   274 PCLSNFLTEMSGVAAGSLDMEADP--LSRPFTLSLPVDGAQRASQTTGFSTFTPSTTVS------ 330

  Fly   344 RKRQFDVASLLAP 356
                 |.||.|.|
Zfish   331 -----DWASPLPP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
foxi3bNP_944600.1 FH 130..218 CDD:214627 43/87 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.