DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxl2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:279 Identity:80/279 - (28%)
Similarity:112/279 - (40%) Gaps:97/279 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PEEP----KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLND 185
            ||:|    ||.:||:.||||||..|.:.:|.||.|||||:..:|::.....||:||||||||||:
  Rat    42 PEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE 106

  Fly   186 CFIKSGRSANG--KGHYWAIHPANMEDFRKGDFRRRKAQRKVRK----HM--------------G 230
            ||||..|...|  ||:||.:.||..:.|.||::|||:..::..:    |.              |
  Rat   107 CFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGSGGGAGG 171

  Fly   231 LSVDDASTDS---PSPPPL----------DLTTPPPPSSQSALQLSALGY--------------- 267
            ..|..|..|.   .:||..          .|..||.|...::.|::|...               
  Rat   172 CGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPG 236

  Fly   268 ----------------PYHQHYIGQFFNRSSAPGMTH---------YSPPDPALLMQRQEANNLD 307
                            ||     .:..:.:..||:.:         .:||.|.            
  Rat   237 AAAVVKGLAGPAASYGPY-----SRVQSMALPPGVVNSYNGLGGPPAAPPPPP------------ 284

  Fly   308 QTIQPTQLQQPHSHHQHFA 326
               .|.....||:||.|.|
  Rat   285 ---PPHPHPHPHAHHLHAA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 46/87 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.