DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxc1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:319 Identity:93/319 - (29%)
Similarity:131/319 - (41%) Gaps:77/319 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGG----------TGGSGASAPWLHLSPYGH--HGSGSLPSVNRMAALSTISLFPQTQRIFQP 125
            |..||          ..|.|.:|....:|.|.|  |.......:.|.....|    ||.    ||
  Rat    17 PYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYT----PQP----QP 73

  Fly   126 EE-PKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIK 189
            :: .||.:|||.||.|||.::.|.|:.|:.|||:|:|.:|::|....||:||||||||||:||:|
  Rat    74 KDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVK 138

  Fly   190 SGRSAN--GKGHYWAIHPANMEDFRKGDFRRRK-----------AQRKVRKHM------------ 229
            ..|...  |||.||.:.|.:...|..|.|.||:           .:.|.|.|:            
  Rat   139 VPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKGRLHLQEPPPPQAGRQP 203

  Fly   230 -GLSVDDASTDSPSP--PPLDL--------TTPPPP---------SSQSALQLSALGYPYHQHYI 274
             ....:.|...:|.|  ||:.:        |.|.||         .|.||..:..:..|      
  Rat   204 APAPPEQAEGSAPGPQQPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIESP------ 262

  Fly   275 GQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAYINSTTT 333
                 .||:..::..|.|..:|...|..:.:..:...|.|...|..|.|.|:..|..|:
  Rat   263 -----DSSSSSLSSGSSPPGSLPSARPLSLDAAEPAPPPQPAPPPHHSQGFSVDNIMTS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 43/87 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.