DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXK2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_004505.2 Gene:FOXK2 / 3607 HGNCID:6036 Length:660 Species:Homo sapiens


Alignment Length:393 Identity:115/393 - (29%)
Similarity:152/393 - (38%) Gaps:123/393 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGGTGGSGASAPWLHLSPYGHHGSG-----SLPS-VNRMAALSTISLFPQTQRIFQPE----- 126
            |...||..:..|.|   .||.|...||     .:|| :|.||..|            |||     
Human   198 PSPTGTISAANSCP---SSPRGAGSSGYKVGRVMPSDLNLMADNS------------QPENEKEA 247

  Fly   127 --------EPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSL 183
                    :.||.:||..||..||..:.|.:|.|:.||.:|..||||:|:...||:|||||||||
Human   248 SGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSL 312

  Fly   184 NDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRK--------------AQRKV---RKHM 229
            |..|||..||..  |||.:|.|.||:.....:..||:|:              :.|..   ..|.
Human   313 NRYFIKVPRSQEEPGKGSFWRIDPASESKLIEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHA 377

  Fly   230 G-LSVDDASTDSP-------SPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGM 286
            | ||...:...:|       ||.||:   |.|.::|..|.:           |.:.....||||.
Human   378 GVLSAHSSGAQTPESLSREGSPAPLE---PEPGAAQPKLAV-----------IQEARFAQSAPGS 428

  Fly   287 THYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVA 351
            ...|.| ..:.:|||    |.|.|:|               :..|..|.:....||         
Human   429 PLSSQP-VLITVQRQ----LPQAIKP---------------VTYTVATPVTTSTSQ--------- 464

  Fly   352 SLLAPDVQIVDIVSEDQESSVTPTTS---ARTTTQTHHTVITKQTI-------------HREVVL 400
               .|.||.|.:|.:....|||....   |.|.|.:...|:|...:             ||||.:
Human   465 ---PPVVQTVHVVHQIPAVSVTSVAGLAPANTYTVSGQAVVTPAAVLAPPKAEAQENGDHREVKV 526

  Fly   401 GLE 403
            .:|
Human   527 KVE 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
FOXK2NP_004505.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
FHA 47..154 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..104
Required for interaction with DVL2 and SUDS3. /evidence=ECO:0000269|PubMed:25805136 129..171
COG5025 <180..577 CDD:227358 115/393 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..260 18/71 (25%)
Forkhead 257..343 CDD:365978 43/85 (51%)
DNA-binding, major groove. /evidence=ECO:0000269|PubMed:16624804 300..318 13/17 (76%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 328..332 2/3 (67%)
DNA-binding, minor groove. /evidence=ECO:0000269|PubMed:16624804 348..353 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 359..407 11/50 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 610..632
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.