DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and slp2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster


Alignment Length:311 Identity:86/311 - (27%)
Similarity:122/311 - (39%) Gaps:79/311 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRS 193
            ||.:||..||.|||..|::.:|.|:.||:||:.|:||:|....||:||||||||||.||:|..|.
  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244

  Fly   194 AN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLD--------L 248
            .:  |||:||.:.|:..:.|..|...:.:.:........|:....|...|..|.|.        |
  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFL 309

  Fly   249 TTPP-PPSSQSAL-----QLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLD 307
            |.|| .||..:::     ..:..|.|.|.............||......|.|...:....::.|.
  Fly   310 TYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELY 374

  Fly   308 QTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSV 372
            |.:|..||.     |||.|                        |:.||         :..::.||
  Fly   375 QRLQYQQLL-----HQHAA------------------------AAALA---------AHQRQLSV 401

  Fly   373 TPTTSARTTTQTHHTVITKQTIHREVVLG-----------------LEKPV 406
            ...::|.....|||        |..:.:|                 |.|||
  Fly   402 AAASAASQPPPTHH--------HPHLAVGQAPLSPGGDSPGPSPQPLHKPV 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
slp2NP_476834.1 Forkhead 180..265 CDD:306709 42/84 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445521
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.780

Return to query results.
Submit another query.