DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and slp1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:229 Identity:75/229 - (32%)
Similarity:104/229 - (45%) Gaps:42/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRS 193
            ||.:||..||.|||..|.:.:|.|:.||||:::.:|||::...||:||||||||||.||.|..||
  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184

  Fly   194 AN--GKGHYWAIHPANMEDF---RKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPP 253
            .:  |||:||.:.|:..|.|   ..|..|        ||:.|     ||....:.....:.:|..
  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLR--------RKNPG-----ASRTRLAAYRQAIFSPMM 236

  Fly   254 PSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQ- 317
            .:|......|:.|||             :.|    ::....|.|.||..........|..|.|| 
  Fly   237 AASPYGAPASSYGYP-------------AVP----FAAAAAAALYQRMNPAAYQAAYQQMQYQQA 284

  Fly   318 PHSHHQ---HFAYINSTTTTTIANMFSQTRKRQF 348
            |.:||.   |.|.:........|.:|   ::.||
  Fly   285 PQAHHHQAPHPAQMQGYPQQLNAELF---QRMQF 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/88 (50%)
slp1NP_476730.1 FH 120..205 CDD:214627 43/84 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.