DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and fd19B

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:268 Identity:78/268 - (29%)
Similarity:114/268 - (42%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDI 155
            ||...|.|||     ..::.|:.|....:..:......||..:|..||.|||.||::.:|.||.|
  Fly    25 SPISKHNSGS-----SFSSCSSSSSNSSSDSMAAKSNAKPAFTYSALIVMAIWSSSEKRLTLSGI 84

  Fly   156 YQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRR 218
            .::|.||:||:|:|...|:||||||||||..|::..|:.:  |:|||||:.| ..||...|:...
  Fly    85 CKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRALDDPGRGHYWALDP-YAEDLSIGETTG 148

  Fly   219 RKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQLSALGYPY-------HQHYIGQ 276
            |..:...:::.|                             .:....|:||       |.|..|.
  Fly   149 RLRRSNWQQNTG-----------------------------ARPKVTGHPYQRMPYYGHGHGNGP 184

  Fly   277 FFNRSSA--PGMTHYSPPDPALLMQRQEA--NNLDQTIQPTQLQQPHSH-HQHFAYINSTTTTTI 336
            :....||  |.|.|   ...|.::|..:|  :.......|...|..|.| |.|..:|..:....|
  Fly   185 YIKAHSAYFPIMDH---QHHAAMVQHYQAMMHRYQMMPHPHHHQHQHQHQHPHSHFIQQSKPLHI 246

  Fly   337 ANMFSQTR 344
            ...:..||
  Fly   247 QEPYHHTR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
fd19BNP_608369.1 FH 58..135 CDD:238016 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.