DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxo6

DIOPT Version :10

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_918949.1 Gene:Foxo6 / 329934 MGIID:2676586 Length:559 Species:Mus musculus


Alignment Length:151 Identity:51/151 - (33%)
Similarity:74/151 - (49%) Gaps:27/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 SYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRG-----PGWRNSIRHNLSLNDCFIKSGR 192
            ||..||..||.|:.|.:|.||.||.:::...|||:.:|     .||:|||||||||:..||:...
Mouse    92 SYADLITKAIESAPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNLSLHTRFIRVQN 156

  Fly   193 SANGKGHYWAIHPANMEDFRKGDFRRR----------------KAQRKVRKHM-GLSVDDASTDS 240
            ...||..:|.::|   |..:.|...||                ||.:|.:.|: ..|.||:...:
Mouse   157 EGTGKSSWWMLNP---EGGKTGKTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGA 218

  Fly   241 PSPPPLDLTT--PPPPSSQSA 259
            |.|.||..:.  ...|:|.::
Mouse   219 PVPGPLSASAKWAASPASHAS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 FH_FOXQ2-like 129..223 CDD:410809 40/110 (36%)
Foxo6NP_918949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..77
FH_FOXO6 89..176 CDD:410837 35/86 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..183 6/22 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..232 11/34 (32%)
FOXO_KIX_bdg 358..>380 CDD:465228
FOXO-TAD 499..537 CDD:435506
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..559
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.